PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009588514.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 361aa    MW: 39864.5 Da    PI: 8.131
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009588514.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding65.31.2e-201661147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEdell ++v+++G+++W++I++ ++ gR++k+c++rw + 
   XP_009588514.1 16 KGPWSPEEDELLQQLVHKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 61
                     79******************************.***********985 PP

2Myb_DNA-binding574.4e-1870112347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEde +++a++++G++ W+tIar ++ gRt++ +k++w++ 
   XP_009588514.1  70 AFTPEEDETIIRAHARFGNK-WATIARLLN-GRTDNAIKNHWNST 112
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.8951166IPR017930Myb domain
SuperFamilySSF466892.73E-3213109IPR009057Homeodomain-like
SMARTSM007174.0E-181564IPR001005SANT/Myb domain
PfamPF002491.6E-201661IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.7E-271769IPR009057Homeodomain-like
CDDcd001671.95E-171860No hitNo description
SMARTSM007173.8E-1567115IPR001005SANT/Myb domain
PROSITE profilePS5129421.44768117IPR017930Myb domain
CDDcd001672.44E-1270113No hitNo description
PfamPF002491.4E-1570112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2370116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MANSSNSSKK DMDRVKGPWS PEEDELLQQL VHKHGPRNWS LISKSIPGRS GKSCRLRWCN  60
QLSPQVEHRA FTPEEDETII RAHARFGNKW ATIARLLNGR TDNAIKNHWN STLKRKSSSL  120
SADEGNELAD QIFQNEQPPL KRSVSAGSAM PVSGFHFSPG SPSGSDSDSS LHVTSSSQSH  180
LFKPVARAGG VFPPPSIDTS SPSDDPPTSL SLSLPGVDSV EFSNRSVEST QSKNPFQMLP  240
VAMQIPPPPP PPPQAAAVPF QRALNQETAG EQQDKVFVPF SQELLGVMQE MIKAEVRNYM  300
VGIEQQQFQQ QQQQQRYQQQ QQFQQQNHQM PSGIGLGLCM QQATDGFRNT GANRMGVSKI  360
D
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-39151163104C-Myb DNA-Binding Domain
1msf_C1e-39151163104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6368200.0EF636820.1 Nicotiana langsdorffii x Nicotiana sanderae sucrose responsive element binding factor 2 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009588514.10.0PREDICTED: transcription factor MYB44
RefseqXP_016478014.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW12e-93MYB44_ARATH; Transcription factor MYB44
TrEMBLM1CC460.0M1CC46_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000643060.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15862471
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67300.11e-75myb domain protein r1